ABCC8 anticorps
-
- Antigène Voir toutes ABCC8 Anticorps
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCC8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
- Top Product
- Discover our top product ABCC8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
- Autre désignation
- ABCC8 (ABCC8 Produits)
- Synonymes
- anticorps ABC36, anticorps HHF1, anticorps HI, anticorps HRINS, anticorps MRP8, anticorps PHHI, anticorps SUR, anticorps SUR1, anticorps SUR1delta2, anticorps TNDM2, anticorps D930031B21Rik, anticorps Sur, anticorps Sur1, anticorps ATP binding cassette subfamily C member 8, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 8, anticorps ABCC8, anticorps Abcc8
- Sujet
- ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.
- Poids moléculaire
- 177 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-