EBP anticorps
-
- Antigène Voir toutes EBP Anticorps
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EBP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
- Top Product
- Discover our top product EBP Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EBP Blocking Peptide, catalog no. 33R-5513, is also available for use as a blocking control in assays to test for specificity of this EBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
- Autre désignation
- EBP (EBP Produits)
- Synonymes
- anticorps cdpx2, anticorps cho2, anticorps cpx, anticorps cpxd, anticorps zgc:91895, anticorps CDPX2, anticorps CHO2, anticorps CPX, anticorps CPXD, anticorps AI255399, anticorps Pabp, anticorps Td, anticorps mSI, anticorps emopamil binding protein (sterol isomerase), anticorps emopamil binding protein (sterol isomerase) L homeolog, anticorps phenylalkylamine Ca2+ antagonist (emopamil) binding protein, anticorps Ebp, anticorps ebp.L, anticorps ebp, anticorps EBP
- Sujet
- EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.
- Poids moléculaire
- 26 kDa (MW of target protein)
-