LTB anticorps
-
- Antigène Voir toutes LTB Anticorps
- LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LTB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS
- Top Product
- Discover our top product LTB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LTB Blocking Peptide, catalog no. 33R-1610, is also available for use as a blocking control in assays to test for specificity of this LTB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))
- Autre désignation
- LTB (LTB Produits)
- Synonymes
- anticorps AI662801, anticorps LTbeta, anticorps Tnfc, anticorps Tnfsf3, anticorps p33, anticorps TNFC, anticorps TNFSF3, anticorps LT-b, anticorps LT-beta, anticorps TNF-C, anticorps lymphotoxin B, anticorps lymphotoxin beta, anticorps Ltb, anticorps LTB
- Sujet
- Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB
-