Transferrin Receptor 2 anticorps (N-Term)
-
- Antigène Voir toutes Transferrin Receptor 2 (TFR2) Anticorps
- Transferrin Receptor 2 (TFR2)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Transferrin Receptor 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TFR2 antibody was raised against the N terminal of TFR2
- Purification
- Affinity purified
- Immunogène
- TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP
- Top Product
- Discover our top product TFR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TFR2 Blocking Peptide, catalog no. 33R-7800, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Transferrin Receptor 2 (TFR2)
- Autre désignation
- TFR2 (TFR2 Produits)
- Synonymes
- anticorps TFR2, anticorps Trfr2, anticorps HFE3, anticorps TFRC2, anticorps zgc:123043, anticorps transferrin receptor 2, anticorps TFR2, anticorps Tfr2, anticorps tfr2
- Sujet
- TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.
- Poids moléculaire
- 89 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-