Junctophilin 3 anticorps (N-Term)

N° du produit ABIN635279

Détail du produit anti-Junctophilin 3 anticorps

Antigène: Junctophilin 3 (JPH3)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Junctophilin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Junctophilin 3 antibody was raised against the N terminal of JPH3

Purification: Affinity purified

Immunogène: Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Junctophilin 3 Blocking Peptide, catalog no. 33R-8805, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Junctophilin 3

Antigène: Junctophilin 3 (JPH3)

Autre désignation: Junctophilin 3 (JPH3 Produits)

Synonymes: anticorps CAGL237, anticorps HDL2, anticorps JP-3, anticorps JP3, anticorps TNRC22, anticorps Jp3, anticorps fc26e06, anticorps si:ch211-255l14.9, anticorps wu:fc26e06, anticorps junctophilin 3, anticorps JPH3, anticorps Jph3, anticorps jph3

Sujet: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH3 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD)-like 2 locus have been identified in the gene that encodes JPH3 protein.

Poids moléculaire: 81 kDa (MW of target protein)