ELAPOR1 anticorps (N-Term)
-
- Antigène Voir toutes ELAPOR1 Anticorps
- ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELAPOR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA1324 antibody was raised against the N terminal of KIAA1324
- Purification
- Affinity purified
- Immunogène
- KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW
- Top Product
- Discover our top product ELAPOR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA1324 Blocking Peptide, catalog no. 33R-6992, is also available for use as a blocking control in assays to test for specificity of this KIAA1324 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1324 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))
- Autre désignation
- KIAA1324 (ELAPOR1 Produits)
- Synonymes
- anticorps EIG121, anticorps BB183350, anticorps Kiaa1324, anticorps mKIAA1324, anticorps KIAA1324, anticorps RIKEN cDNA 5330417C22 gene, anticorps KIAA1324, anticorps 5330417C22Rik
- Sujet
- KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.
- Poids moléculaire
- 111 kDa (MW of target protein)
-