ELAPOR1 anticorps (N-Term)

N° du produit ABIN635280

Détail du produit anti-ELAPOR1 anticorps

Antigène: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELAPOR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1324 antibody was raised against the N terminal of KIAA1324

Purification: Affinity purified

Immunogène: KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1324 Blocking Peptide, catalog no. 33R-6992, is also available for use as a blocking control in assays to test for specificity of this KIAA1324 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1324 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELAPOR1

Antigène: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Autre désignation: KIAA1324 (ELAPOR1 Produits)

Synonymes: anticorps EIG121, anticorps BB183350, anticorps Kiaa1324, anticorps mKIAA1324, anticorps KIAA1324, anticorps RIKEN cDNA 5330417C22 gene, anticorps KIAA1324, anticorps 5330417C22Rik

Sujet: KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

Poids moléculaire: 111 kDa (MW of target protein)