KTN1 anticorps

N° du produit ABIN635282

Détail du produit anti-KTN1 anticorps

Antigène: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KTN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Kinectin 1 Blocking Peptide, catalog no. 33R-2373, is also available for use as a blocking control in assays to test for specificity of this Kinectin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KTN1

Antigène: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Autre désignation: Kinectin 1 (KTN1 Produits)

Synonymes: anticorps cb213, anticorps wu:fi20e02, anticorps wu:fi27f06, anticorps CG1, anticorps KNT, anticorps MU-RMS-40.19, anticorps kinectin 1, anticorps kinectin, anticorps kinectin 1 L homeolog, anticorps Ktn1, anticorps ktn1, anticorps KTN1, anticorps CpipJ_CPIJ006678, anticorps CpipJ_CPIJ006680, anticorps CpipJ_CPIJ007437, anticorps ktn1.L

Sujet: Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin, an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule.

Poids moléculaire: 150 kDa (MW of target protein)