ABCC3 anticorps
-
- Antigène Voir toutes ABCC3 Anticorps
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
- Top Product
- Discover our top product ABCC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCC3 Blocking Peptide, catalog no. 33R-4707, is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
- Autre désignation
- ABCC3 (ABCC3 Produits)
- Synonymes
- anticorps ABC31, anticorps EST90757, anticorps MLP2, anticorps MOAT-D, anticorps MRP3, anticorps cMOAT2, anticorps 1700019L09Rik, anticorps Mlp2, anticorps Mrp3, anticorps ATP binding cassette subfamily C member 3, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 3, anticorps ABCC3, anticorps Abcc3
- Sujet
- ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined, however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
- Poids moléculaire
- 168 kDa (MW of target protein)
-