SLC44A3 anticorps (N-Term)

N° du produit ABIN635295

Détail du produit anti-SLC44A3 anticorps

Antigène: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC44A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC44 A3 antibody was raised against the N terminal of SLC44 3

Purification: Affinity purified

Immunogène: SLC44 A3 antibody was raised using the N terminal of SLC44 3 corresponding to a region with amino acids MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC44A3 Blocking Peptide, catalog no. 33R-6087, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC44A3

Antigène: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Autre désignation: SLC44A3 (SLC44A3 Produits)

Synonymes: anticorps CTL3, anticorps BC010552, anticorps RGD1305808, anticorps solute carrier family 44 member 3, anticorps solute carrier family 44, member 3, anticorps SLC44A3, anticorps slc44a3, anticorps Slc44a3

Sujet: SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

Poids moléculaire: 68 kDa (MW of target protein)