OSBPL8 anticorps (N-Term)
-
- Antigène Voir toutes OSBPL8 Anticorps
- OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OSBPL8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OSBPL8 antibody was raised against the N terminal of OSBPL8
- Purification
- Affinity purified
- Immunogène
- OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS
- Top Product
- Discover our top product OSBPL8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))
- Autre désignation
- OSBPL8 (OSBPL8 Produits)
- Synonymes
- anticorps RGD1561474, anticorps DKFZp469P0923, anticorps MST120, anticorps MSTP120, anticorps ORP8, anticorps OSBP10, anticorps AA536976, anticorps AA536995, anticorps C730029P18Rik, anticorps D330025H14Rik, anticorps ORP-8, anticorps oxysterol binding protein-like 8, anticorps oxysterol binding protein like 8, anticorps oxysterol binding protein like 8 L homeolog, anticorps oxysterol-binding protein-related protein 8, anticorps Osbpl8, anticorps OSBPL8, anticorps osbpl8.L, anticorps osbpl8, anticorps LOC100175952
- Sujet
- OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.
- Poids moléculaire
- 97 kDa (MW of target protein)
-