OSBPL8 anticorps (N-Term)

N° du produit ABIN635298

Détail du produit anti-OSBPL8 anticorps

Antigène: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSBPL8 est non-conjugé

Application: Western Blotting (WB)

Specificité: OSBPL8 antibody was raised against the N terminal of OSBPL8

Purification: Affinity purified

Immunogène: OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSBPL8

Antigène: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Autre désignation: OSBPL8 (OSBPL8 Produits)

Synonymes: anticorps RGD1561474, anticorps DKFZp469P0923, anticorps MST120, anticorps MSTP120, anticorps ORP8, anticorps OSBP10, anticorps AA536976, anticorps AA536995, anticorps C730029P18Rik, anticorps D330025H14Rik, anticorps ORP-8, anticorps oxysterol binding protein-like 8, anticorps oxysterol binding protein like 8, anticorps oxysterol binding protein like 8 L homeolog, anticorps oxysterol-binding protein-related protein 8, anticorps Osbpl8, anticorps OSBPL8, anticorps osbpl8.L, anticorps osbpl8, anticorps LOC100175952

Sujet: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Poids moléculaire: 97 kDa (MW of target protein)