ACBD5 anticorps (N-Term)

N° du produit ABIN635304

Détail du produit anti-ACBD5 anticorps

Antigène: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACBD5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACBD5 antibody was raised against the N terminal of ACBD5

Purification: Affinity purified

Immunogène: ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACBD5 Blocking Peptide, catalog no. 33R-1108, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACBD5

Antigène: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Autre désignation: ACBD5 (ACBD5 Produits)

Synonymes: anticorps MGC89100, anticorps 1300014E15Rik, anticorps F15A18.90, anticorps F15A18_90, anticorps acyl-CoA binding protein 5, anticorps zgc:112043, anticorps acyl-CoA binding domain containing 5, anticorps acyl-CoA binding domain containing 5 L homeolog, anticorps acyl-Coenzyme A binding domain containing 5, anticorps acyl-CoA binding protein 5, anticorps acyl-CoA binding domain containing 5a, anticorps ACBD5, anticorps Acbd5, anticorps acbd5.L, anticorps acbd5, anticorps ACBP5, anticorps acbd5a

Sujet: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

Poids moléculaire: 55 kDa (MW of target protein)