ACBD5 anticorps (C-Term)
-
- Antigène Voir toutes ACBD5 Anticorps
- ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACBD5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACBD5 antibody was raised against the C terminal of ACBD5
- Purification
- Affinity purified
- Immunogène
- ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR
- Top Product
- Discover our top product ACBD5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACBD5 Blocking Peptide, catalog no. 33R-9785, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))
- Autre désignation
- ACBD5 (ACBD5 Produits)
- Synonymes
- anticorps MGC89100, anticorps 1300014E15Rik, anticorps F15A18.90, anticorps F15A18_90, anticorps acyl-CoA binding protein 5, anticorps zgc:112043, anticorps acyl-CoA binding domain containing 5, anticorps acyl-CoA binding domain containing 5 L homeolog, anticorps acyl-Coenzyme A binding domain containing 5, anticorps acyl-CoA binding protein 5, anticorps acyl-CoA binding domain containing 5a, anticorps ACBD5, anticorps Acbd5, anticorps acbd5.L, anticorps acbd5, anticorps ACBP5, anticorps acbd5a
- Sujet
- ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.
- Poids moléculaire
- 55 kDa (MW of target protein)
-