RRBP1 anticorps
-
- Antigène Voir toutes RRBP1 Anticorps
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RRBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF
- Top Product
- Discover our top product RRBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RRBP1 Blocking Peptide, catalog no. 33R-9024, is also available for use as a blocking control in assays to test for specificity of this RRBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
- Autre désignation
- RRBP1 (RRBP1 Produits)
- Synonymes
- anticorps 1700087N07Rik, anticorps 5730465C04Rik, anticorps ES/130, anticorps mKIAA1398, anticorps mRRp0, anticorps mRRp1.8, anticorps mRRp10, anticorps mRRp15a, anticorps mRRp15b, anticorps mRRp16.8, anticorps mRRp2, anticorps mRRp41, anticorps mRRp47, anticorps mRRp5.4, anticorps p180, anticorps ES130, anticorps RRp, anticorps hES, anticorps P180, anticorps rrbp1, anticorps sb:cb489, anticorps wu:fc47a01, anticorps ribosome binding protein 1, anticorps ribosome binding protein 1 homolog 180kDa (dog), anticorps ribosome binding protein 1b, anticorps Rrbp1, anticorps RRBP1, anticorps rrbp1b
- Sujet
- Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized.
- Poids moléculaire
- 109 kDa (MW of target protein)
-