TMTC4 anticorps (C-Term)

N° du produit ABIN635307

Détail du produit anti-TMTC4 anticorps

Antigène: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMTC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMTC4 antibody was raised against the C terminal of TMTC4

Purification: Affinity purified

Immunogène: TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMTC4 Blocking Peptide, catalog no. 33R-6658, is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMTC4

Antigène: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Autre désignation: TMTC4 (TMTC4 Produits)

Synonymes: anticorps si:ch211-168k14.1, anticorps wu:fc58d04, anticorps 4930403J22Rik, anticorps 5730419O14Rik, anticorps RGD1560183, anticorps transmembrane and tetratricopeptide repeat containing 4, anticorps tmtc4, anticorps TMTC4, anticorps Tmtc4

Sujet: TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Poids moléculaire: 83 kDa (MW of target protein)