MUC15 anticorps (Middle Region)
-
- Antigène Voir toutes MUC15 Anticorps
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MUC15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MUC15 antibody was raised against the middle region of MUC15
- Purification
- Affinity purified
- Immunogène
- MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
- Top Product
- Discover our top product MUC15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MUC15 Blocking Peptide, catalog no. 33R-4381, is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
- Autre désignation
- MUC15 (MUC15 Produits)
- Synonymes
- anticorps 4732460E09, anticorps D730046L02Rik, anticorps MUC-15, anticorps PAS3, anticorps PASIII, anticorps mucin 15, cell surface associated, anticorps mucin 15, anticorps MUC15, anticorps Muc15
- Sujet
- MUC15 may play a role in the cell adhesion to the extracellular matrix.
- Poids moléculaire
- 36 kDa (MW of target protein)
-