PGRMC1 anticorps (N-Term)

N° du produit ABIN635310

Cet anticorps anti-PGRMC1 Polyclonal Lapin (ABIN635310) détecte spécifiquement PGRMC1 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PGRMC1 anticorps (N-Term) (ABIN635310)

Antigène: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGRMC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PGRMC1 anticorps

Épitope: N-Term

Specificité: PGRMC1 antibody was raised against the N terminal of PGRMC1

Purification: Affinity purified

Immunogène: PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGRMC1 Blocking Peptide, (ABIN5615336), is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGRMC1

Antigène: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Autre désignation: PGRMC1

Sujet: Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.

Poids moléculaire: 22 kDa (MW of target protein)