PGRMC1 anticorps (N-Term)
-
- Antigène Voir toutes PGRMC1 Anticorps
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGRMC1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PGRMC1 antibody was raised against the N terminal of PGRMC1
- Purification
- Affinity purified
- Immunogène
- PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
- Top Product
- Discover our top product PGRMC1 Anticorps primaire
-
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 1-195) antibody
PGRMC1 Reactivité: Humain IHC, ELISA, FACS, ICC Hôte: Souris Monoclonal 7G11G8 unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 44-195) antibodyPGRMC1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyVerified PGRMC1 Reactivité: Humain, Souris WB, IHC, ELISA, IF Hôte: Chèvre Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyPGRMC1 Reactivité: Humain, Souris, Rat WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 96-195) antibodyPGRMC1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 3F7 unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 67-102), (Middle Region) antibodyPGRMC1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (N-Term) antibodyPGRMC1 Reactivité: Humain, Boeuf (Vache), Chien, Cheval, Lapin WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyPGRMC1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (N-Term) antibodyPGRMC1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Porc WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
- Autre désignation
- PGRMC1 (PGRMC1 Produits)
- Synonymes
- anticorps MGC89150, anticorps wu:fa94d03, anticorps zgc:103577, anticorps DKFZp469D0815, anticorps HPR6.6, anticorps MPR, anticorps AA415812, anticorps PPMR, anticorps Vema, anticorps 25-Dx, anticorps 25Dx, anticorps VEMA, anticorps progesterone receptor membrane component 1, anticorps pgrmc1, anticorps PGRMC1, anticorps Pgrmc1
- Sujet
- Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.
- Poids moléculaire
- 22 kDa (MW of target protein)
-
