TCTA anticorps (Middle Region)

N° du produit ABIN635313

Détail du produit anti-TCTA anticorps

Antigène: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCTA est non-conjugé

Application: Western Blotting (WB)

Specificité: TCTA antibody was raised against the middle region of TCTA

Purification: Affinity purified

Immunogène: TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCTA Blocking Peptide, catalog no. 33R-4114, is also available for use as a blocking control in assays to test for specificity of this TCTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCTA

Antigène: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Autre désignation: TCTA (TCTA Produits)

Synonymes: anticorps PXYLT2, anticorps XT-II, anticorps XT2, anticorps xylT-II, anticorps 9130410M22Rik, anticorps AW553637, anticorps C85065, anticorps Tctal, anticorps wu:fb06g04, anticorps zgc:92721, anticorps xylosyltransferase 2, anticorps T-cell leukemia translocation altered, anticorps T cell leukemia translocation altered gene, anticorps T-cell leukemia translocation altered S homeolog, anticorps T-cell leukemia translocation altered gene, anticorps XYLT2, anticorps TCTA, anticorps Tcta, anticorps tcta.S, anticorps tcta

Sujet: A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).

Poids moléculaire: 11 kDa (MW of target protein)