ACBD4 anticorps (N-Term)
-
- Antigène Voir toutes ACBD4 Anticorps
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACBD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACBD4 antibody was raised against the N terminal of ACBD4
- Purification
- Affinity purified
- Immunogène
- ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
- Top Product
- Discover our top product ACBD4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Autre désignation
- ACBD4 (ACBD4 Produits)
- Synonymes
- anticorps zgc:85611, anticorps F22F7.13, anticorps F22F7_13, anticorps acyl-CoA binding protein 4, anticorps 2010009P05Rik, anticorps 2010015A21Rik, anticorps AI849317, anticorps acyl-CoA binding domain containing 4, anticorps acyl-CoA binding protein 4, anticorps acyl-Coenzyme A binding domain containing 4, anticorps ACBD4, anticorps acbd4, anticorps Acbd4, anticorps ACBP4
- Sujet
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
- Poids moléculaire
- 35 kDa (MW of target protein)
-