ABCB1 anticorps
-
- Antigène Voir toutes ABCB1 Anticorps
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
- Top Product
- Discover our top product ABCB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
- Autre désignation
- ABCB1 (ABCB1 Produits)
- Synonymes
- anticorps ABC20, anticorps CD243, anticorps CLCS, anticorps GP170, anticorps MDR1, anticorps P-GP, anticorps PGY1, anticorps Abcb1, anticorps Mdr1a, anticorps p-gp, anticorps xemdr, anticorps Mdr1, anticorps Mdr1b, anticorps Pgy-1, anticorps Pgy1, anticorps mdr, anticorps ABCB1, anticorps PGP1, anticorps ATP binding cassette subfamily B member 1, anticorps ATP binding cassette subfamily B member 1A, anticorps ATP binding cassette subfamily B member 1 L homeolog, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps ABCB1, anticorps Abcb1a, anticorps abcb1.L, anticorps Abcb1b, anticorps Abcb1
- Sujet
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Poids moléculaire
- 141 kDa (MW of target protein)
-