Lamin B Receptor anticorps (Middle Region)
-
- Antigène Voir toutes Lamin B Receptor (LBR) Anticorps
- Lamin B Receptor (LBR)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Lamin B Receptor est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Lamin B Receptor antibody was raised against the middle region of LBR
- Purification
- Affinity purified
- Immunogène
- Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
- Top Product
- Discover our top product LBR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Lamin B Receptor Blocking Peptide, catalog no. 33R-3164, is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Lamin B Receptor (LBR)
- Autre désignation
- Lamin B Receptor (LBR Produits)
- Synonymes
- anticorps CG17952, anticorps Dmel\\CG17952, anticorps dLBR, anticorps sb:cb406, anticorps zgc:86649, anticorps wu:fb75h08, anticorps wu:fc47b04, anticorps wu:fd36b07, anticorps lbr-A, anticorps Xp58, anticorps p58 gene, anticorps LBR, anticorps DHCR14B, anticorps LMN2R, anticorps PHA, anticorps TDRD18, anticorps AI505894, anticorps ic, anticorps Nbp60, anticorps lamin B receptor, anticorps Lamin B receptor, anticorps lamin B receptor S homeolog, anticorps LBR, anticorps lbr, anticorps lbr.S, anticorps Lbr
- Sujet
- The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
- Poids moléculaire
- 71 kDa (MW of target protein)
-