TM4SF20 anticorps (Middle Region)
-
- Antigène Voir toutes TM4SF20 Anticorps
- TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TM4SF20 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TM4 SF20 antibody was raised against the middle region of TM4 F20
- Purification
- Affinity purified
- Immunogène
- TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG
- Top Product
- Discover our top product TM4SF20 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TM4SF20 Blocking Peptide, catalog no. 33R-7465, is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))
- Autre désignation
- TM4SF20 (TM4SF20 Produits)
- Synonymes
- anticorps pro994, anticorps tcce518, anticorps PRO994, anticorps TCCE518, anticorps 1810018L02Rik, anticorps transmembrane 4 L six family member 20, anticorps transmembrane 4 L six family member 20 L homeolog, anticorps TM4SF20, anticorps Tm4sf20, anticorps tm4sf20.L, anticorps tm4sf20
- Sujet
- TM4SF20 functions as a cellular component of the plasma membrane.
- Poids moléculaire
- 25 kDa (MW of target protein)
-