Calsyntenin 1 anticorps (N-Term)
-
- Antigène Voir toutes Calsyntenin 1 (CLSTN1) Anticorps
- Calsyntenin 1 (CLSTN1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Calsyntenin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
- Purification
- Affinity purified
- Immunogène
- Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
- Top Product
- Discover our top product CLSTN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Calsyntenin 1 (CLSTN1)
- Autre désignation
- Calsyntenin 1 (CLSTN1 Produits)
- Synonymes
- anticorps CALSYNTENIN-1, anticorps fm67g03, anticorps wu:fk52g02, anticorps wu:fm67g03, anticorps zgc:153744, anticorps zgc:56528, anticorps clstn1, anticorps 1810034E21Rik, anticorps Cst-1, anticorps Cstn1, anticorps ALC-ALPHA, anticorps CDHR12, anticorps CSTN1, anticorps PIK3CD, anticorps XB31alpha, anticorps alcalpha1, anticorps alcalpha2, anticorps calsyntenin 1, anticorps calsyntenin 3, anticorps beta-catenin-interacting protein 1, anticorps calsyntenin-1, anticorps CLSTN1, anticorps clstn1, anticorps clstn3, anticorps LOC100356725, anticorps LOC100435584, anticorps Clstn1, anticorps LOC479600
- Sujet
- CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
- Poids moléculaire
- 110 kDa (MW of target protein)
-