AWAT1 anticorps (N-Term)

N° du produit ABIN635354

Détail du produit anti-AWAT1 anticorps

Antigène: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AWAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AWAT1 antibody was raised against the N terminal of AWAT1

Purification: Affinity purified

Immunogène: AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AWAT1

Antigène: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Autre désignation: AWAT1 (AWAT1 Produits)

Synonymes: anticorps DGAT2L3, anticorps Dgat2l3, anticorps dga2, anticorps dgat2l3, anticorps DGA2, anticorps acyl-CoA wax alcohol acyltransferase 1, anticorps acyl-CoA wax alcohol acyltransferase 1 L homeolog, anticorps AWAT1, anticorps Awat1, anticorps awat1.L, anticorps awat1

Sujet: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.

Poids moléculaire: 38 kDa (MW of target protein)