ABHD12 anticorps (Middle Region)

N° du produit ABIN635357

Détail du produit anti-ABHD12 anticorps

Antigène: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABHD12 est non-conjugé

Application: Western Blotting (WB)

Specificité: ABHD12 antibody was raised against the middle region of ABHD12

Purification: Affinity purified

Immunogène: ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABHD12

Antigène: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Autre désignation: ABHD12 (ABHD12 Produits)

Synonymes: anticorps ABHD12, anticorps 1500011G07Rik, anticorps 6330583M11Rik, anticorps AI431047, anticorps AW547313, anticorps ABHD12A, anticorps BEM46L2, anticorps C20orf22, anticorps PHARC, anticorps dJ965G21.2, anticorps abhydrolase domain containing 12, anticorps abhydrolase domain containing 12 S homeolog, anticorps ABHD12, anticorps CC1G_02966, anticorps PTRG_02160, anticorps abhd12.S, anticorps Abhd12

Sujet: ABHD12 may be a regulator of endocannabinoid signaling pathways.

Poids moléculaire: 45 kDa (MW of target protein)