SLC16A1 anticorps
-
- Antigène Voir toutes SLC16A1 Anticorps
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC16A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
- Top Product
- Discover our top product SLC16A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC16A1 Blocking Peptide, catalog no. 33R-2496, is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
- Autre désignation
- SLC16A1 (SLC16A1 Produits)
- Synonymes
- anticorps HHF7, anticorps MCT, anticorps MCT1, anticorps MCT1a, anticorps cb517, anticorps zgc:55682, anticorps slc16a1, anticorps MGC52993, anticorps SLC16A1, anticorps DKFZp469B1212, anticorps AL022710, anticorps Mct1, anticorps RATMCT1, anticorps RNMCT1, anticorps solute carrier family 16 member 1, anticorps solute carrier family 16 (monocarboxylate transporter), member 1b, anticorps solute carrier family 16 member 1 S homeolog, anticorps solute carrier family 16 (monocarboxylic acid transporters), member 1, anticorps SLC16A1, anticorps slc16a1b, anticorps slc16a1.S, anticorps Slc16a1
- Sujet
- SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes.
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- L'effet Warburg
-