SLC33A1 anticorps
-
- Antigène Voir toutes SLC33A1 Anticorps
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC33A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
- Top Product
- Discover our top product SLC33A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
- Autre désignation
- SLC33A1 (SLC33A1 Produits)
- Synonymes
- anticorps zgc:63693, anticorps ACATN, anticorps AT-1, anticorps AT1, anticorps CCHLND, anticorps SPG42, anticorps AI315656, anticorps AI788741, anticorps Acatn, anticorps D630022N01Rik, anticorps solute carrier family 33 (acetyl-CoA transporter), member 1, anticorps solute carrier family 33 member 1, anticorps slc33a1, anticorps SLC33A1, anticorps Slc33a1
- Sujet
- SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.
- Poids moléculaire
- 61 kDa (MW of target protein)
-