SLC12A8 anticorps
-
- Antigène Voir toutes SLC12A8 (Slc12a8) Anticorps
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC12A8 est non-conjugé
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS
- Top Product
- Discover our top product Slc12a8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC12A8 Blocking Peptide, catalog no. 33R-4006, is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
- Autre désignation
- SLC12A8 (Slc12a8 Produits)
- Synonymes
- anticorps CCC9, anticorps E330020C02Rik, anticorps Ccc9, anticorps solute carrier family 12 member 8, anticorps zinc finger protein 148, anticorps solute carrier family 12 (potassium/chloride transporters), member 8, anticorps solute carrier family 12, member 8, anticorps solute carrier family 12, member 8 L homeolog, anticorps SLC12A8, anticorps ZNF148, anticorps Slc12a8, anticorps slc12a8.L
- Sujet
- SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.
- Poids moléculaire
- 78 kDa (MW of target protein)
-