SLC35F3 anticorps (Middle Region)

N° du produit ABIN635380

Détail du produit anti-SLC35F3 anticorps

Antigène: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35F3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 F3 antibody was raised against the middle region of SLC35 3

Purification: Affinity purified

Immunogène: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35F3 Blocking Peptide, catalog no. 33R-5111, is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35F3

Antigène: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Autre désignation: SLC35F3 (SLC35F3 Produits)

Synonymes: anticorps B230375D17Rik, anticorps slc35f3, anticorps zgc:171853, anticorps solute carrier family 35 member F3, anticorps putative thiamine transporter SLC35F3, anticorps solute carrier family 35, member F3, anticorps solute carrier family 35, member F3a, anticorps SLC35F3, anticorps LOC718789, anticorps Slc35f3, anticorps slc35f3a

Sujet: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Poids moléculaire: 55 kDa (MW of target protein)