TMEM195 anticorps (N-Term)

N° du produit ABIN635386

Détail du produit anti-TMEM195 anticorps

Antigène: TMEM195 (Transmembrane Protein 195 (TMEM195))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM195 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM195 antibody was raised against the N terminal of TMEM195

Purification: Affinity purified

Immunogène: TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM195 Blocking Peptide, catalog no. 33R-6155, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM195

Antigène: TMEM195 (Transmembrane Protein 195 (TMEM195))

Autre désignation: TMEM195 (TMEM195 Produits)

Synonymes: anticorps TMEM195, anticorps A530016O06Rik, anticorps AI790538, anticorps Tmem195, anticorps RGD1312038, anticorps alkylglycerol monooxygenase, anticorps AGMO, anticorps Agmo

Sujet: TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.

Poids moléculaire: 51 kDa (MW of target protein)