TMEM195 anticorps (N-Term)
-
- Antigène Voir toutes TMEM195 Anticorps
- TMEM195 (Transmembrane Protein 195 (TMEM195))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM195 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM195 antibody was raised against the N terminal of TMEM195
- Purification
- Affinity purified
- Immunogène
- TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
- Top Product
- Discover our top product TMEM195 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM195 Blocking Peptide, catalog no. 33R-9719, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM195 (Transmembrane Protein 195 (TMEM195))
- Autre désignation
- TMEM195 (TMEM195 Produits)
- Synonymes
- anticorps TMEM195, anticorps A530016O06Rik, anticorps AI790538, anticorps Tmem195, anticorps RGD1312038, anticorps alkylglycerol monooxygenase, anticorps AGMO, anticorps Agmo
- Sujet
- TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.
- Poids moléculaire
- 51 kDa (MW of target protein)
-