TTYH1 anticorps

N° du produit ABIN635388

Détail du produit anti-TTYH1 anticorps

Antigène: TTYH1 (Tweety Homolog 1 (TTYH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTYH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTYH1 Blocking Peptide, catalog no. 33R-3168, is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTYH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTYH1

Antigène: TTYH1 (Tweety Homolog 1 (TTYH1))

Autre désignation: TTYH1 (TTYH1 Produits)

Synonymes: anticorps 4930459B04Rik, anticorps 6330408P11Rik, anticorps tty, anticorps TTYH1, anticorps ttyh1-A, anticorps tweety family member 1, anticorps tweety family member 1 L homeolog, anticorps Protein tweety homolog 1, anticorps Ttyh1, anticorps TTYH1, anticorps ttyh1.L, anticorps ttyh-1

Sujet: TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Poids moléculaire: 49 kDa (MW of target protein)