NIPA2 anticorps (Middle Region)
-
- Antigène Voir toutes NIPA2 Anticorps
- NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NIPA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NIPA2 antibody was raised against the middle region of NIPA2
- Purification
- Affinity purified
- Immunogène
- NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV
- Top Product
- Discover our top product NIPA2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))
- Autre désignation
- NIPA2 (NIPA2 Produits)
- Sujet
- NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-