NIPA2 anticorps (Middle Region)

N° du produit ABIN635392

Détail du produit anti-NIPA2 anticorps

Antigène: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NIPA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NIPA2 antibody was raised against the middle region of NIPA2

Purification: Affinity purified

Immunogène: NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NIPA2

Antigène: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Autre désignation: NIPA2 (NIPA2 Produits)

Synonymes: anticorps RGD1306051, anticorps fb72g02, anticorps wu:fb72g02, anticorps zgc:66088, anticorps 2600017P10Rik, anticorps 3830408P04Rik, anticorps AB041581, anticorps non imprinted in Prader-Willi/Angelman syndrome 2, anticorps non imprinted in Prader-Willi/Angelman syndrome 2 (human), anticorps non imprinted in Prader-Willi/Angelman syndrome 2 homolog (human), anticorps NIPA2, anticorps Nipa2, anticorps nipa2

Sujet: NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization