ITPRIPL1 anticorps (C-Term)

N° du produit ABIN635393

Détail du produit anti-ITPRIPL1 anticorps

Antigène: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITPRIPL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1754 L antibody was raised against the C terminal of KIAA1754

Purification: Affinity purified

Immunogène: KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1754L Blocking Peptide, catalog no. 33R-2453, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITPRIPL1

Antigène: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Autre désignation: KIAA1754L (ITPRIPL1 Produits)

Synonymes: anticorps 1700041B20Rik, anticorps KIAA1754L, anticorps inositol 1,4,5-triphosphate receptor interacting protein-like 1, anticorps ITPRIP like 1, anticorps inositol 1,4,5-trisphosphate receptor interacting protein-like 1, anticorps Itpripl1, anticorps ITPRIPL1

Sujet: The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 61 kDa (MW of target protein)