C1orf151 anticorps (Middle Region)

N° du produit ABIN635405

Détail du produit anti-C1orf151 anticorps

Antigène: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Épitope: Middle Region

Reactivité: Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf151 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF151 antibody was raised against the middle region of C1 rf151

Purification: Affinity purified

Immunogène: C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf151

Antigène: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Autre désignation: C1ORF151 (C1orf151 Produits)

Synonymes: anticorps C1orf151, anticorps MIO10, anticorps RGD1560187, anticorps 2310028O11Rik, anticorps mitochondrial inner membrane organizing system 1, anticorps MINOS1, anticorps Minos1

Sujet: The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 9 kDa (MW of target protein)