YIF1B anticorps

N° du produit ABIN635410

Détail du produit anti-YIF1B anticorps

Antigène: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YIF1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur YIF1B

Antigène: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Autre désignation: YIF1B (YIF1B Produits)

Synonymes: anticorps FinGER8, anticorps MGC83008, anticorps 9430029K10Rik, anticorps Yip1b, anticorps zgc:103562, anticorps finger8, anticorps MGC76182, anticorps yif1b, anticorps Yip1 interacting factor homolog B, membrane trafficking protein S homeolog, anticorps Yip1 interacting factor homolog B (S. cerevisiae), anticorps Yip1 interacting factor homolog B, membrane trafficking protein, anticorps protein YIF1B, anticorps Yip1 interacting factor homolog B, membrane trafficking protein L homeolog, anticorps yif1b.S, anticorps Yif1b, anticorps YIF1B, anticorps yif1b, anticorps LOC100380764, anticorps yif1b.L

Sujet: YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.

Poids moléculaire: 31 kDa (MW of target protein)