ART3 anticorps (Middle Region)
-
- Antigène Voir toutes ART3 Anticorps
- ART3 (ADP-Ribosyltransferase 3 (ART3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ART3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ART3 antibody was raised against the middle region of ART3
- Purification
- Affinity purified
- Immunogène
- ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA
- Top Product
- Discover our top product ART3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ART3 (ADP-Ribosyltransferase 3 (ART3))
- Autre désignation
- ART3 (ART3 Produits)
- Synonymes
- anticorps ARTC3, anticorps 4930569O04Rik, anticorps ART3, anticorps DKFZp468P1925, anticorps ADP-ribosyltransferase 3, anticorps ART3, anticorps Art3
- Sujet
- ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.
- Poids moléculaire
- 40 kDa (MW of target protein)
-