Integrin beta 5 anticorps (Middle Region)
-
- Antigène Voir toutes Integrin beta 5 (ITGB5) Anticorps
- Integrin beta 5 (ITGB5)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Integrin beta 5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Integrin Beta 5 antibody was raised against the middle region of ITGB5
- Purification
- Affinity purified
- Immunogène
- Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL
- Top Product
- Discover our top product ITGB5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Integrin beta 5 (ITGB5)
- Autre désignation
- Integrin beta 5 (ITGB5 Produits)
- Synonymes
- anticorps ITGB5, anticorps AA475909, anticorps AI874634, anticorps ESTM23, anticorps [b]-5, anticorps [b]5, anticorps [b]5A, anticorps [b]5B, anticorps beta-5, anticorps beta5, anticorps RGD1563276, anticorps integrin, beta 5, anticorps integrin beta 5, anticorps integrin subunit beta 5, anticorps ITGB5, anticorps Itgb5
- Sujet
- Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.
- Poids moléculaire
- 88 kDa (MW of target protein)
- Pathways
- Integrin Complex
-