Ribophorin II anticorps (Middle Region)
-
- Antigène Voir toutes Ribophorin II (RPN2) Anticorps
- Ribophorin II (RPN2)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Ribophorin II est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Ribophorin II antibody was raised against the middle region of RPN2
- Purification
- Affinity purified
- Immunogène
- Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
- Top Product
- Discover our top product RPN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ribophorin II (RPN2)
- Autre désignation
- Ribophorin II (RPN2 Produits)
- Synonymes
- anticorps RIBIIR, anticorps RPN-II, anticorps RPNII, anticorps SWP1, anticorps RPN2, anticorps 1300012C06Rik, anticorps AV261018, anticorps Rpn-2, anticorps fb95d11, anticorps fj62b10, anticorps wu:fb61f08, anticorps wu:fb74e07, anticorps wu:fb95d11, anticorps wu:fj41f11, anticorps wu:fj62b10, anticorps rpn2, anticorps ribophorin II, anticorps dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2, anticorps ribophorin II S homeolog, anticorps RPN2, anticorps Rpn2, anticorps rpn2, anticorps LOC5579328, anticorps Bm1_30625, anticorps rpn2.S
- Sujet
- RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.
- Poids moléculaire
- 67 kDa (MW of target protein)
-