DEGS1 anticorps

N° du produit ABIN635423

Détail du produit anti-DEGS1 anticorps

Antigène: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DEGS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DEGS1 Blocking Peptide, catalog no. 33R-3584, is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DEGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DEGS1

Antigène: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Autre désignation: DEGS1 (DEGS1 Produits)

Synonymes: anticorps DEGS, anticorps DEGS-1, anticorps DES1, anticorps Des-1, anticorps FADS7, anticorps MLD, anticorps degs, anticorps im:6909319, anticorps wu:fa25h01, anticorps wu:fb81d06, anticorps Degs, anticorps AA536663, anticorps Des1, anticorps Mdes, anticorps delta 4-desaturase, sphingolipid 1, anticorps delta(4)-desaturase, sphingolipid 1, anticorps DEGS1, anticorps degs1, anticorps Degs1

Sujet: DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.

Poids moléculaire: 38 kDa (MW of target protein)