CHST2 anticorps

N° du produit ABIN635427

Détail du produit anti-CHST2 anticorps

Antigène: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHST2 Blocking Peptide, catalog no. 33R-6649, is also available for use as a blocking control in assays to test for specificity of this CHST2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST2

Antigène: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Autre désignation: CHST2 (CHST2 Produits)

Synonymes: anticorps chst2, anticorps wu:fj55f04, anticorps zgc:154070, anticorps CHST2, anticorps C6ST, anticorps GST-2, anticorps GST2, anticorps Gn6ST-1, anticorps glcNAc6ST-1, anticorps AI428561, anticorps AW121776, anticorps C130041E03Rik, anticorps Chts2, anticorps GlcNAc6ST, anticorps Gn6st, anticorps carbohydrate sulfotransferase 2, anticorps carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2a, anticorps carbohydrate sulfotransferase 4, anticorps carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, anticorps carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 L homeolog, anticorps CHST2, anticorps chst2a, anticorps CHST4, anticorps chst2, anticorps chst2.L, anticorps Chst2

Sujet: N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process