HS3ST3B1 anticorps
-
- Antigène Voir toutes HS3ST3B1 Anticorps
- HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HS3ST3B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HS3 ST3 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
- Top Product
- Discover our top product HS3ST3B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HS3ST3B1 Blocking Peptide, catalog no. 33R-1387, is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))
- Autre désignation
- HS3ST3B1 (HS3ST3B1 Produits)
- Synonymes
- anticorps 30ST3B1, anticorps 3OST3B1, anticorps 3-OST-3B, anticorps 3Ost3b, anticorps AU041882, anticorps AW536289, anticorps Hs3st3b, anticorps m3-OST-3B, anticorps zgc:152967, anticorps HS3ST3B1, anticorps heparan sulfate-glucosamine 3-sulfotransferase 3B1, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1, anticorps heparan sulfate glucosamine 3-O-sulfotransferase 3B1, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1b, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1a, anticorps heparan sulfate glucosamine 3-O-sulfotransferase 3B1-like, anticorps HS3ST3B1, anticorps Hs3st3b1, anticorps LOC489516, anticorps hs3st3b1b, anticorps hs3st3b1a, anticorps HS3ST3B1L
- Sujet
- HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-