RER1 anticorps

N° du produit ABIN635434

Détail du produit anti-RER1 anticorps

Antigène: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RER1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RER1

Antigène: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Autre désignation: RER1 (RER1 Produits)

Synonymes: anticorps RER1, anticorps DKFZp459K116, anticorps rer1, anticorps zgc:65968, anticorps 1110060F11Rik, anticorps 5830454N22Rik, anticorps AU043380, anticorps RGD1306324, anticorps retention in endoplasmic reticulum sorting receptor 1, anticorps RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae), anticorps retention in endoplasmic reticulum sorting receptor 1 L homeolog, anticorps RER1, anticorps rer1, anticorps rer1.L, anticorps Rer1

Sujet: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Poids moléculaire: 23 kDa (MW of target protein)