CHIC2 anticorps (N-Term)
-
- Antigène Voir toutes CHIC2 Anticorps
- CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHIC2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CHIC2 antibody was raised against the N terminal of CHIC2
- Purification
- Affinity purified
- Immunogène
- CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
- Top Product
- Discover our top product CHIC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHIC2 Blocking Peptide, catalog no. 33R-2382, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))
- Autre désignation
- CHIC2 (CHIC2 Produits)
- Synonymes
- anticorps zgc:55670, anticorps BTL, anticorps 1700081B18Rik, anticorps 4930502K01Rik, anticorps cysteine rich hydrophobic domain 2, anticorps cysteine-rich hydrophobic domain 2, anticorps cysteine rich hydrophobic domain 2 S homeolog, anticorps CHIC2, anticorps CpipJ_CPIJ013126, anticorps chic2, anticorps chic2.S, anticorps Chic2
- Sujet
- CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.
- Poids moléculaire
- 19 kDa (MW of target protein)
-