TRAM2 anticorps (N-Term)

N° du produit ABIN635438

Détail du produit anti-TRAM2 anticorps

Antigène: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAM2 antibody was raised against the N terminal of TRAM2

Purification: Affinity purified

Immunogène: TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAM2 Blocking Peptide, catalog no. 33R-5990, is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAM2

Antigène: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Autre désignation: TRAM2 (TRAM2 Produits)

Synonymes: anticorps C330003D03Rik, anticorps wu:fb20c11, anticorps wu:fi23a12, anticorps zgc:111902, anticorps zgc:55869, anticorps zgc:76937, anticorps tram2, anticorps translocation associated membrane protein 2, anticorps tram-like protein, anticorps TraM-like protein, anticorps translocating chain-associating membrane protein 2, anticorps translocation associated membrane protein 2 L homeolog, anticorps TRAM2, anticorps CJE0444, anticorps BT_p548215, anticorps traM, anticorps CJJ81176_0418, anticorps Tram2, anticorps tram2, anticorps tram2.L

Sujet: TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.

Poids moléculaire: 43 kDa (MW of target protein)