SYNGR4 anticorps (N-Term)
-
- Antigène Voir toutes SYNGR4 Anticorps
- SYNGR4 (Synaptogyrin 4 (SYNGR4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SYNGR4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4
- Purification
- Affinity purified
- Immunogène
- Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
- Top Product
- Discover our top product SYNGR4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SYNGR4 (Synaptogyrin 4 (SYNGR4))
- Autre désignation
- Synaptogyrin 4 (SYNGR4 Produits)
- Synonymes
- anticorps 1700016O14Rik, anticorps synaptogyrin 4, anticorps SYNGR4, anticorps Syngr4
- Sujet
- SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.
- Poids moléculaire
- 26 kDa (MW of target protein)
-