ST6GALNAC6 anticorps (C-Term)

N° du produit ABIN635440

Détail du produit anti-ST6GALNAC6 anticorps

Antigène: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST6GALNAC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST6 GALNAC6 antibody was raised against the C terminal of ST6 ALNAC6

Purification: Affinity purified

Immunogène: ST6 GALNAC6 antibody was raised using the C terminal of ST6 ALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST6GALNAC6 Blocking Peptide, catalog no. 33R-10129, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST6GALNAC6

Antigène: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Autre désignation: ST6GALNAC6 (ST6GALNAC6 Produits)

Synonymes: anticorps RP11-203J24.3, anticorps SIAT7F, anticorps ST6GALNACVI, anticorps siat7f, anticorps st6GalNAc-VI, anticorps Siat7f, anticorps MGC109387, anticorps ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, anticorps ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, anticorps ST6GALNAC6, anticorps St6galnac6

Sujet: ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Poids moléculaire: 38 kDa (MW of target protein)