Ferric-Chelate Reductase 1 Like (FRRS1L) (Middle Region) anticorps
-
- Antigène Voir toutes Ferric-Chelate Reductase 1 Like (FRRS1L) Anticorps
- Ferric-Chelate Reductase 1 Like (FRRS1L)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- C9 ORF4 antibody was raised against the middle region of C9 rf4
- Purification
- Affinity purified
- Immunogène
- C9 ORF4 antibody was raised using the middle region of C9 rf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
- Top Product
- Discover our top product FRRS1L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C9ORF4 Blocking Peptide, catalog no. 33R-3707, is also available for use as a blocking control in assays to test for specificity of this C9ORF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ferric-Chelate Reductase 1 Like (FRRS1L)
- Autre désignation
- C9ORF4 (FRRS1L Produits)
- Synonymes
- anticorps C9orf4, anticorps CG-6, anticorps CG6, anticorps 6430704M03Rik, anticorps ferric chelate reductase 1 like, anticorps ferric-chelate reductase 1 like, anticorps FRRS1L, anticorps Frrs1l
- Sujet
- The function of C9orf4 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 37 kDa (MW of target protein)
-