EDEM1 anticorps (N-Term)

N° du produit ABIN635444

Détail du produit anti-EDEM1 anticorps

Antigène: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EDEM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EDEM1 antibody was raised against the N terminal of EDEM1

Purification: Affinity purified

Immunogène: EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EDEM1 Blocking Peptide, catalog no. 33R-5674, is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDEM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EDEM1

Antigène: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Autre désignation: EDEM1 (EDEM1 Produits)

Synonymes: anticorps zgc:55816, anticorps edem, anticorps EDEM1, anticorps EDEM, anticorps A130059K23Rik, anticorps mKIAA0212, anticorps RGD1563633, anticorps ER degradation enhancer, mannosidase alpha-like 1, anticorps ER degradation enhancing alpha-mannosidase like protein 1, anticorps ER degradation-enhancing alpha-mannosidase-like protein 1, anticorps ER degradation enhancing alpha-mannosidase like protein 1 L homeolog, anticorps edem1, anticorps EDEM1, anticorps LOC100637820, anticorps edem1.L, anticorps Edem1

Sujet: EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.

Poids moléculaire: 74 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling