TM9SF4 anticorps (N-Term)

N° du produit ABIN635445

Détail du produit anti-TM9SF4 anticorps

Antigène: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TM9SF4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TM9 SF4 antibody was raised against the N terminal of TM9 F4

Purification: Affinity purified

Immunogène: TM9 SF4 antibody was raised using the N terminal of TM9 F4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TM9SF4 Blocking Peptide, catalog no. 33R-3826, is also available for use as a blocking control in assays to test for specificity of this TM9SF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TM9SF4

Antigène: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Autre désignation: TM9SF4 (TM9SF4 Produits)

Synonymes: anticorps dJ836N17.2, anticorps AA986553, anticorps AU045326, anticorps B930079E06, anticorps mKIAA0255, anticorps transmembrane 9 superfamily member 4, anticorps transmembrane 9 superfamily protein member 4, anticorps TM9SF4, anticorps Tm9sf4

Sujet: TM9SF4 is required for phagocytosis in S2 cells.

Poids moléculaire: 72 kDa (MW of target protein)