PTDSS1 anticorps (N-Term)

N° du produit ABIN635446

Détail du produit anti-PTDSS1 anticorps

Antigène: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTDSS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTDSS1 antibody was raised against the N terminal of PTDSS1

Purification: Affinity purified

Immunogène: PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTDSS1 Blocking Peptide, catalog no. 33R-5738, is also available for use as a blocking control in assays to test for specificity of this PTDSS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTDSS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTDSS1

Antigène: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Autre désignation: PTDSS1 (PTDSS1 Produits)

Synonymes: anticorps PSS-1, anticorps zgc:55906, anticorps PSS1, anticorps PSSA, anticorps AU044268, anticorps AW539008, anticorps mKIAA0024, anticorps phosphatidylserine synthase 1a, anticorps phosphatidylserine synthase 1, anticorps ptdss1a, anticorps PTDSS1, anticorps Ptdss1

Sujet: PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.

Poids moléculaire: 55 kDa (MW of target protein)